A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10201 |
| Swiss-prot Accession number | Q6SV86 (Sequence in FASTA format) |
| Description | Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain). |
| Source organism | Bubalus bubalis (Domestic water buffalo) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bubalus. |
| Subcellular location | Secreted (By similarity) |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Stimulates development of follicle and spermatogenesis in the reproductive organs |
| Protein Length | 129 Amino acids |
| Molecular weight | 14593 |
| References | 1 Wang A., Shi D., Li N.; "Sequence analysis of the water buffalo follicle stimulating hormone-beta subunit gene."; Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases.
2 Yadav S.P., Goswami S.L., De S., Datta T.K., Yadav P., Raghvan S.,Singh R.; Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases. 3 Wang A., Shi D., Li N.; "Sequence analysis of the water buffalo follicle stimulating hormone-beta subunit gene."; Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases. 4 Yadav S.P., Goswami S.L., De S., Datta T.K., Yadav P., Raghvan S.,Singh R.; Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Cys_knot |
| Hormone Name | Follicle-stimulating hormone beta subunit |
| Mature Hormone Sequence | CELTNITITVEKEECGFCISINTTWCAGYCYTRDLVYRDPARPNIQKTCTYKELVYETVKVPGCAHHADSLYTYPVATECQCGKCDGDSTDCTVRGLGPSYCSFSESRE |
| Position of mature hormone in Pre-Hormone protein | 109 Residues from position (21-129) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10215 |
| Swiss-prot Accession number | Q9GL36 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
| Source organism | Bubalus bubalis (Domestic water buffalo) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bubalus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 120 Amino acids |
| Molecular weight | 13574 |
| References | 1 Chand H.S.; Thesis (2000), University of Delhi, India.
2 Chand H.S.; Thesis (2000), University of Delhi, India. |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | FPDGEFTMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS |
| Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10723 |
| Swiss-prot Accession number | O18938 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Bubalus bubalis (Domestic water buffalo) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bubalus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
| Protein Length | 217 Amino acids |
| Molecular weight | 24618 |
| References | 1 Tiwari G., Garg L.C.; "Cloning and characterization of growth hormone encoding gene inBubalus bubalis."; Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 10376211 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | AFPAMSLSSLFANAVLWAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF |
| Position of mature hormone in Pre-Hormone protein | Residues from position 191 |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 11523 |
| Swiss-prot Accession number | Q5J732 (Sequence in FASTA format) |
| Description | Leptin;Alternative Name: Obesity factor; Precursor |
| Source organism | Bubalus bubalis (Domestic water buffalo) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bubalus. |
| Subcellular location | Secreted (Probable) |
| Developmental Stage | N/A |
| Similarity | Belongs to the leptin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity). |
| Protein Length | 167 Amino acids |
| Molecular weight | 18688 |
| References | 1 PubMed abstract 15566470 |
| Domain Name | Leptin |
| Hormone Name | Leptin |
| Mature Hormone Sequence | |
| Position of mature hormone in Pre-Hormone protein | |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 11557 |
| Swiss-prot Accession number | B2CPV3 (Sequence in FASTA format) |
| Description | Leptin |
| Source organism | Bubalus bubalis (Domestic water buffalo) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bubalus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | N/A |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 167 Amino acids |
| Molecular weight | 18688 |
| References | ---- |
| Domain Name | Leptin |
| Hormone Name | Leptin |
| Mature Hormone Sequence | |
| Position of mature hormone in Pre-Hormone protein | |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |